Product - Abyntek Biopharma

Protein

Mouse IL33 protein (Active)

DESCRIPCIÓN

Supplier:	Biorbyt
Reference:	orb359021
Name:	Mouse IL33 protein (Active)
Category:	Protein
Subcategory:	Proteins
Aditional Names:	IL-33,; Interleukin-33109-266,]
Unit:	10 ug
price :	Consultar
format :	Lyophilized powder
note :	Mus musculus (Mouse)
Aa sequence :	SIQGTSLLTQSPASLSTYNDQSVSFVLENGCYVINVDDSGKDQEQDQVLLRYYESPCPASQSGDGVDGKKLMVNMSPIKDTDIWLHANDKDYSVELQRGDVSPPEQAFFVLHKKSSDFVSFECKNLPGTYIGVKDNQLALVEEKDESCNNIMFKLSKI
buffer :	Lyophilized from a 0.2 µm filtered PBS, and 1 mM EDTA
Immunogen sequence :	109-266aa
purity :	> 98% as determined by SDS-PAGE and HPLC.
endotoxin :	Less than 1.0 EU/µg as determined by LAL method.
specificactivity :	Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine D10S cells is less than 0.5 ng/ml, corresponding to a specific activity of ? 2.0 × 106 IU/mg.
tag :	Tag-Free
Molecular weight :	17.5 kDa
Uniprot number :	Q8BVZ5