Product - Abyntek Biopharma

Protein

Mouse Tfam Protein

DESCRIPCIÓN

Supplier:	Biorbyt
Reference:	orb1478008
Name:	Mouse Tfam Protein
Category:	Protein
Subcategory:	Proteins
Aditional Names:	(mtTFA)(Testis-specific high mobility group protein)(TS-HMG)
Unit:	1 mg
price :	Consultar
format :	Liquid or Lyophilized powder
note :	Mus musculus (Mouse)
Aa sequence :	SSMGSYPKKPMSSYLRFSTEQLPKFKAKHPDAKLSELVRKIAALWRELPEAEKKVYEADFKAEWKAYKEAVSKYKEQLTPSQLMGMEKEARQRRLKKKALVKRRELILLGKPKRPRSAYNIYVSESFQEAKDDSAQGKLKLVNEAWKNLSPEEKQAYIQLAKDDRIRYDNEMKSWEEQMAEVGRSDLIRRSVKRSGDISEH
buffer :	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
purity :	Greater than 90% as determined by SDS-PAGE.
endotoxin :	Not test.
tag :	N-terminal 10xHis-tagged and C-terminal Myc-tagged
Molecular weight :	30.9 kDa
Uniprot number :	P40630