Product - Abyntek Biopharma

Protein

Recombinant Galleria mellonella uncharacterized protein LOC113509844 (LOC113509844), partial

DESCRIPCIÓN

Supplier:	Biorbyt
Reference:	orb1785244
Name:	Recombinant Galleria mellonella uncharacterized protein LOC113509844 (LOC113509844), partial
Category:	Protein
Subcategory:	Proteins
Unit:	1 mg
price :	Consultar
format :	Liquid or Lyophilized powder
note :	Galleria mellonella (Greater wax moth)
Aa sequence :	YGWDNSPGRQSWFPNTNQINNRPWQNQFPRPNQNGGQNQFPWQNPIQNGGENQFPPQNQQQIQPSTPPTNSNSRLPNDVRSCISSCPVTSEYNPVCGTDLVTYSNPGRLVCARTCGVNVSQLRTSPCPTTTVAMSLRLLLAVIVVSQVTSKTHYGFGDYPMHRRPDFHYPGWGHHHADWGSYPWNSQESGED
buffer :	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
purity :	Greater than 85% as determined by SDS-PAGE.
endotoxin :	Not test.
tag :	N-terminal 6xHis-tagged
Molecular weight :	25.7 kDa
Uniprot number :	A0A6J1W8F4