Product - Abyntek Biopharma

Protein

Recombinant Human C-C chemokine receptor type 6(CCR6)-VLPs (Active)

DESCRIPCIÓN

Supplier:	Biorbyt
Reference:	orb1881863
Name:	Recombinant Human C-C chemokine receptor type 6(CCR6)-VLPs (Active)
Category:	Protein
Subcategory:	Proteins
Aditional Names:	CKRL3;CMKBR6;GPR29;STRL22
Unit:	20 ug
price :	Consultar
format :	Lyophilized powder
note :	Homo sapiens (Human)
Aa sequence :	MSGESMNFSDVFDSSEDYFVSVNTSYYSVDSEMLLCSLQEVRQFSRLFVPIAYSLICVFGLLGNILVVITFAFYKKARSMTDVYLLNMAIADILFVLTLPFWAVSHATGAWVFSNATCKLLKGIYAINFNCGMLLLTCISMDRYIAIVQATKSFRLRSRTLPRSKIICLVVWGLSVIISSSTFVFNQKYNTQGSDVCEPKYQTVSEPIRWKLLMLGLELLFGFFIPLMFMIFCYTFIVKTLVQAQNSKRHKAIRV
buffer :	Lyophilized from a 0.2 ?m filtered PBS, 6% Trehalose, pH 7.4
purity :	Testing in progress.
endotoxin :	Less than 1.0 EU/ug as determined by LAL method.
specificactivity :	Measured by its binding ability in a functional ELISA. Immobilized Human CCR6 at 10 ?g/mL can bind Anti-CCR6 recombinant antibody (CSB-RA004845MA1HU). The EC50 is 44.79-56.10 ng/mL. The VLPs (CSB-MP3838) is negative control.
tag :	C-terminal 10xHis-tagged(This tag can be tested only under denaturing conditions)
Molecular weight :	42.5 kDa
Uniprot number :	P51684