Product - Abyntek Biopharma

Protein

E.coli mdh protein

DESCRIPCIÓN

Supplier:	Biorbyt
Reference:	orb244369
Name:	E.coli mdh protein
Category:	Protein
Subcategory:	Proteins
Aditional Names:	mdh, b3236, JW3205 Malate dehydrogenase
Unit:	100 ug
price :	Consultar
format :	Liquid or Lyophilized powder
note :	Bacillus subtilis (strain 168)
Aa sequence :	GNTRKKVSVIGAGFTGATTAFLIAQKELADVVLVDIPQLENPTKGKALDMLEASPVQGFDAKITGTSNYEDTAGSDIVVITAGIARKPGMSRDDLVSTNEKIMRSVTQEIVKYSPDSIIVVLTNPVDAMTYAVYKESGFPKERVIGQSGVLDTARFRTFVAEELNLSVKDVTGFVLGGHGDDMVPLVRYSYAGGIPLETLIPKERIDAIVERTRKGGGEIVNLLGNGSAYYAPAASLTEMVEAILKDQRRVLPTI
buffer :	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Immunogen sequence :	2-312aa
purity :	Greater than 90% as determined by SDS-PAGE.
endotoxin :	Not test.
tag :	N-terminal 6xHis-tagged
Molecular weight :	37.5 kDa
Uniprot number :	P49814