Product - Abyntek Biopharma

Protein

Human CD206 protein

DESCRIPCIÓN

Supplier:	Biorbyt
Reference:	orb358106
Name:	Human CD206 protein
Category:	Protein
Subcategory:	Proteins
Aditional Names:	C type lectin domain family 13 member D protein, C-type lectin domain family 13 member D protein, CD 206 protein, CD206 protein, CD206 antigen protein, CLEC13D protein, CLEC13DL protein, Macrophage mannose receptor 1 protein, Macrophage mannose receptor 1 like protein 1 protein, Macrophage mannose receptor protein, Mannose receptor C type 1 protein, Mannose receptor C type 1 like 1 protein, MMR protein, MRC 1 protein, MRC1 protein, MRC1L1 protein
Unit:	1 mg
price :	Consultar
format :	Liquid or Lyophilized powder
note :	Homo sapiens (Human)
Aa sequence :	RTSLCFKLYAKGKHEKKTWFESRDFCRALGGDLASINNKEEQQTIWRLITASGSYHKLFWLGLTYGSPSEGFTWSDGSPVSYENWAYGEPNNYQNVEYCGELKGDPTMSWNDINCEHLNNWICQIQKGQTPKPEPTPAPQDNPPVTEDGWVIYKDYQYYFSKEKETMDNARAFCKRNFGDLVSIQSESEKKFLWKYVNRNDAQSAYFIGLLISLDKKFAWMDGSKVDYVSWATGEPNFANEDENCVTMYSNSGFW
buffer :	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Immunogen sequence :	655-1213aa
purity :	Greater than 90% as determined by SDS-PAGE.
endotoxin :	Not test.
tag :	N-terminal 6xHis-SUMO-tagged
Molecular weight :	80.4 kDa
Uniprot number :	P22897