Product - Abyntek Biopharma

Protein

Human CCL15 protein (Active)

DESCRIPCIÓN

Supplier:	Biorbyt
Reference:	orb359042
Name:	Human CCL15 protein (Active)
Category:	Protein
Subcategory:	Proteins
Aditional Names:	Chemokine CC-2, Leukotactin-1, LKN-1, MIP-1 delta, Macrophage inflammatory protein 5
Unit:	100 ug
price :	Consultar
format :	Lyophilized powder
note :	Homo sapiens (Human)
Aa sequence :	SFHFAADCCTSYISQSIPCSLMKSYFETSSECSKPGVIFLTKKGRQVCAKPSGPGVQDCMKKLKPYSI
buffer :	Lyophilized from a 0.2 µm filtered PBS, pH 7.4
Immunogen sequence :	46-113aa
purity :	> 98% as determined by SDS-PAGE and HPLC.
endotoxin :	Less than 1.0 EU/µg as determined by LAL method.
specificactivity :	Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human T-lymphocytes is in a concentration range of 1.0-10 ng/ml.
tag :	Tag-Free
Molecular weight :	7.4 kDa
Uniprot number :	Q16663