Product - Abyntek Biopharma

Protein

Human CCL16 protein (Active)

DESCRIPCIÓN

Supplier:	Biorbyt
Reference:	orb359044
Name:	Human CCL16 protein (Active)
Category:	Protein
Subcategory:	Proteins
Aditional Names:	Chemokine CC-4, Chemokine LEC, IL-10-inducible chemokine, LCC-1, Liver-expressed chemokine
Unit:	500 ug
price :	Consultar
format :	Lyophilized powder
note :	Homo sapiens (Human)
Aa sequence :	QPKVPEWVNTPSTCCLKYYEKVLPRRLVVGYRKALNCHLPAIIFVTKRNREVCTNPNDDWVQEYIKDPNLPLLPTRNLSTVKIITAKNGQPQLLNSQ
buffer :	Lyophilized from a 0.2 µm filtered PBS, pH 7.4
Immunogen sequence :	24-120aa
purity :	> 97% as determined by SDS-PAGE and HPLC.
endotoxin :	Less than 1.0 EU/µg as determined by LAL method.
specificactivity :	Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human monocytes is in a concentration range of 10-100 ng/ml.
tag :	Tag-Free
Molecular weight :	11.2 kDa
Uniprot number :	O15467