Product - Abyntek Biopharma

Protein

Monkey CXL10 protein (Active)

DESCRIPCIÓN

Supplier:	Biorbyt
Reference:	orb359087
Name:	Monkey CXL10 protein (Active)
Category:	Protein
Subcategory:	Proteins
Aditional Names:	10 kDa interferon gamma-induced protein, IP-10, Small-inducible cytokine B10
Unit:	5 ug
price :	Consultar
format :	Lyophilized powder
note :	Macaca mulatta (Rhesus macaque)
Aa sequence :	IPLSRTVRCTCISISNQPVNPRSLEKLEIIPPSQFCPHVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP
buffer :	Lyophilized from a 0.2 µm filtered PBS, pH 7.4
Immunogen sequence :	22-98aa
purity :	> 97% as determined by SDS-PAGE and HPLC.
endotoxin :	Less than 1.0 EU/µg as determined by LAL method.
specificactivity :	Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human peripheral blood T-lymphocytes is in a concentration range of 10- 50 ng/ml.
tag :	Tag-Free
Molecular weight :	8.7 kDa
Uniprot number :	Q8MIZ1