Product - Abyntek Biopharma

Protein

Human CCL27 protein (Active)

DESCRIPCIÓN

Supplier:	Biorbyt
Reference:	orb359084
Name:	Human CCL27 protein (Active)
Category:	Protein
Subcategory:	Proteins
Aditional Names:	CC chemokine ILC, CTACK, ESkine, IL-11 R-alpha-locus chemokine, Skinkine
Unit:	500 ug
price :	Consultar
format :	Lyophilized powder
note :	Homo sapiens (Human)
Aa sequence :	FLLPPSTACCTQLYRKPLSDKLLRKVIQVELQEADGDCHLQAFVLHLAQRSICIHPQNPSLSQWFEHQERKLHGTLPKLNFGMLRKMG
buffer :	Lyophilized from a 0.2 µm filtered PBS, pH 7.4
Immunogen sequence :	25-112aa
purity :	> 96% as determined by SDS-PAGE and HPLC.
endotoxin :	Less than 1.0 EU/µg as determined by LAL method.
specificactivity :	Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using CCR10 transfected BaF3 cells is in a concentration range of 10-100 ng/ml.
tag :	Tag-Free
Molecular weight :	10.1 kDa
Uniprot number :	Q9Y4X3