Product - Abyntek Biopharma

Protein

Rat CCL11 protein (Active)

DESCRIPCIÓN

Supplier:	Biorbyt
Reference:	orb359137
Name:	Rat CCL11 protein (Active)
Category:	Protein
Subcategory:	Proteins
Aditional Names:	C-C motif chemokine 11, Small-inducible cytokine A11
Unit:	5 ug
price :	Consultar
format :	Lyophilized powder
note :	Rattus norvegicus (Rat)
Aa sequence :	HPGSIPTSCCFTMTSKKIPNTLLKSYKRITNNRCTLKAIVFKTKLGKEICADPKKKWVQDATKHLDQKLQTPKP
buffer :	Lyophilized from a 0.2 µm filtered PBS, pH 7.4
Immunogen sequence :	24-97aa
purity :	> 96% as determined by SDS-PAGE and HPLC.
endotoxin :	Less than 1.0 EU/µg as determined by LAL method.
specificactivity :	Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using purified eosinophils is in a concentration range of 0.1-1.0 ?g/ml.
tag :	Tag-Free
Molecular weight :	8.4 kDa
Uniprot number :	P97545