Product - Abyntek Biopharma

Protein

Human FGF23 protein (Active)

DESCRIPCIÓN

Supplier:	Biorbyt
Reference:	orb359159
Name:	Human FGF23 protein (Active)
Category:	Protein
Subcategory:	Proteins
Aditional Names:	FGF-23, Tumor-derived hypophosphatemia-inducing factor,
Unit:	500 ug
price :	Consultar
format :	Lyophilized powder
note :	Homo sapiens (Human)
Aa sequence :	YPNASPLLGSSWGGLIHLYTATARNSYHLQIHKNGHVDGAPHQTIYSALMIRSEDAGFVVITGVMSRRYLCMDFRGNIFGSHYFDPENCRFQHQTLENGYDVYHSPQYHFLVSLGRAKRAFLPGMNPPPYSQFLSRRNEIPLIHFNTPIPRRHTRSAEDDSERDPLNVLKPRARMTPAPASCSQELPSAEDNSPMASDPLGVVRGGRVNTHAGGTGPEGCRPFAKFI
buffer :	Lyophilized from a 0.2 µm filtered PBS, pH 7.4
Immunogen sequence :	25-251aa
purity :	> 95% as determined by SDS-PAGE and HPLC.
endotoxin :	Less than 1.0 EU/µg as determined by LAL method.
specificactivity :	Fully biologically active when compared to standard. The ED50 as determined by thymidine uptake assay using FGF-receptors transfected BaF3 cells is less than 0.5 ?g/ml, corresponding to a specific activity of ? 2.0 × 103 IU/mg in the presence of 0.3 µg/ml
tag :	Tag-Free
Molecular weight :	25.3 kDa
Uniprot number :	Q9GZV9