Product - Abyntek Biopharma

Protein

Animal Hirudin variant-1 protein

DESCRIPCIÓN

Supplier:	Biorbyt
Reference:	orb383017
Name:	Animal Hirudin variant-1 protein
Category:	Protein
Subcategory:	Proteins
Aditional Names:	Hirudin variant-1, Hirudin-1, Hirudin-I, Lepirudin
Unit:	1 mg
price :	Consultar
format :	Liquid or Lyophilized powder
note :	Hirudo medicinalis (Medicinal leech)
Aa sequence :	VVYTDCTESGQNLCLCEGSNVCGQGNKCILGSDGEKNQCVTGEGTPKPQSHNDGDFEEIPEEYLQ
buffer :	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Immunogen sequence :	1-65aa
purity :	Greater than 90% as determined by SDS-PAGE.
endotoxin :	Not test.
tag :	N-terminal 6xHis-tagged
Molecular weight :	9 kDa
Uniprot number :	P01050