Product - Abyntek Biopharma

Protein

Human CD1C protein

DESCRIPCIÓN

Supplier:	Biorbyt
Reference:	orb383095
Name:	Human CD1C protein
Category:	Protein
Subcategory:	Proteins
Aditional Names:	BDCA1, CD1, CD1A, CD1c, CD1c antigen, CD1C antigen c polypeptide, CD1c molecule, CD1C_HUMAN, Cortical thymocyte antigen CD1C, Differentiation antigen CD1 alpha 3, R7, T cell surface glycoprotein CD1c, T-cell surface glycoprotein CD1c
Unit:	500 ug
price :	Consultar
format :	Liquid or Lyophilized powder
note :	Homo sapiens (Human)
Aa sequence :	NADASQEHVSFHVIQIFSFVNQSWARGQGSGWLDELQTHGWDSESGTIIFLHNWSKGNFSNEELSDLELLFRFYLFGLTREIQDHASQDYSKYPFEVQVKAGCELHSGKSPEGFFQVAFNGLDLLSFQNTTWVPSPGCGSLAQSVCHLLNHQYEGVTETVYNLIRSTCPRFLLGLLDAGKMYVHRQVRPEAWLSSRPSLGSGQLLLVCHASGFYPKPVWVTWMRNEQEQLGTKHGDILPNADGTWYLQVILEVAS
buffer :	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Immunogen sequence :	18-302aa
purity :	Greater than 90% as determined by SDS-PAGE.
endotoxin :	Not test.
tag :	N-terminal 6xHis-tagged
Molecular weight :	34.2 kDa
Uniprot number :	P29017