Product - Abyntek Biopharma

Protein

Mouse Transthyretin protein

DESCRIPCIÓN

Supplier:	Biorbyt
Reference:	orb383093
Name:	Mouse Transthyretin protein
Category:	Protein
Subcategory:	Proteins
Aditional Names:	anti Amyloidosis Iprotein, anti ATTRprotein, anti CTSprotein, anti CTS1protein, anti HEL111protein, anti HsT2651protein, anti PALBprotein, anti Prealbumin amyloidosis type Iprotein, anti TBPAprotein, anti Transthyretinprotein, anti TTRprotein, anti TTR proteinprotein
Unit:	100 ug
price :	Consultar
format :	Liquid or Lyophilized powder
note :	Mus musculus (Mouse)
Aa sequence :	GPAGAGESKCPLMVKVLDAVRGSPAVDVAVKVFKKTSEGSWEPFASGKTAESGELHGLTTDEKFVEGVYRVELDTKSYWKTLGISPFHEFADVVFTANDSGHRHYTIAALLSPYSYSTTAVVSNPQN
buffer :	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Immunogen sequence :	21-147aa
purity :	Greater than 90% as determined by SDS-PAGE.
endotoxin :	Not test.
tag :	N-terminal 6xHis-tagged
Molecular weight :	15.6 kDa
Uniprot number :	P07309