Product - Abyntek Biopharma

Protein

Bacterial ssaA2 protein

DESCRIPCIÓN

Supplier:	Biorbyt
Reference:	orb383071
Name:	Bacterial ssaA2 protein
Category:	Protein
Subcategory:	Proteins
Aditional Names:	ssaA2, SAV2299, Staphylococcal secretory antigen ssaA2
Unit:	1 mg
price :	Consultar
format :	Liquid or Lyophilized powder
note :	Staphylococcus aureus (strain Mu50 / ATCC 700699)
Aa sequence :	SEQDNYGYNPNDPTSYSYTYTIDAQGNYHYTWKGNWHPSQLNQDNGYYSYYYYNGYNNYNNYNNGYSYNNYSRYNNYSNNNQSYNYNNYNSYNTNSYRTGGLGASYSTSSNNVQVTTTMAPSSNGRSISSGYTSGRNLYTSGQCTYYVFDRVGGKIGSTWGNASNWANAAARAGYTVNNTPKAGAIMQTTQGAYGHVAYVESVNSNGSVRVSEMNYGYGPGVVTSRTISASQAAGYNFIH
buffer :	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Immunogen sequence :	28-267aa
purity :	Greater than 90% as determined by SDS-PAGE.
endotoxin :	Not test.
tag :	N-terminal 6xHis-SUMO-tagged
Molecular weight :	42.7 kDa
Uniprot number :	Q99RX4