Product - Abyntek Biopharma

Protein

Human ICA1 protein

DESCRIPCIÓN

Supplier:	Biorbyt
Reference:	orb383196
Name:	Human ICA1 protein
Category:	Protein
Subcategory:	Proteins
Aditional Names:	69KDA islet cell autoantigen Short name, ICA69 Islet cell autoantigen p69 Short name, ICAp69 Short name, p69
Unit:	500 ug
price :	Consultar
format :	Liquid or Lyophilized powder
note :	Homo sapiens (Human)
Aa sequence :	MSGHKCYPWDLQDRYAQDKSVVNKMQQKYWETKQAFIKATGKKEDEHVVASDADLDAKLELFHSIQRTCLDLSKAIVLYQKRICFLSQEENELGKFLRSQGFQDKTRAGKMMQATGKALCFSSQQRLALRNPLCRFHQEVETFRHRAISDTWLTVNRMEQCRTEYRGALLWMKDVSQELDPDLYKQMEKFRKVQTQVRLAKKNFDKLKMDVCQKVDLLGASRCNLLSHMLATYQTTLLHFWEKTSHTMAAIHESF
buffer :	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Immunogen sequence :	1-482aa
purity :	Greater than 90% as determined by SDS-PAGE.
endotoxin :	Not test.
tag :	N-terminal 6xHis-tagged
Molecular weight :	56.6 kDa
Uniprot number :	Q05084