Product - Abyntek Biopharma

Protein

Mouse EGFL8 protein

DESCRIPCIÓN

Supplier:	Biorbyt
Reference:	orb419184
Name:	Mouse EGFL8 protein
Category:	Protein
Subcategory:	Proteins
Aditional Names:	Ng3
Unit:	1 mg
price :	Consultar
format :	Liquid or Lyophilized powder
note :	Mus musculus (Mouse)
Aa sequence :	GSFKESLGVCSKQTLLVPLRYNESYSQPVYKPYLTLCAGRRICSTYRTTYRVAWREVRREVPQTHVVCCQGWKKPHPGALTCDAICSKPCLNGGVCTGPDRCECAPGWGGKHCHVDVDECRASLTLCSHGCLNTLGSFLCSCPHPLVLGLDGRTCAGGPPESPTSASILSVAVREADSEEERALRWEVAELRGRLEKLEQWATQAGAWVRAVLPMPPEELRPEQVAELWGRGDRIESLSDQVLLLEERLGACACE
buffer :	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Immunogen sequence :	29-293aa
purity :	Greater than 85% as determined by SDS-PAGE.
endotoxin :	Not test.
tag :	N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Molecular weight :	49 kDa
Uniprot number :	Q6GUQ1