Product - Abyntek Biopharma

Protein

E. coli HPH protein

DESCRIPCIÓN

Supplier:	Biorbyt
Reference:	orb419169
Name:	E. coli HPH protein
Category:	Protein
Subcategory:	Proteins
Aditional Names:	APH(4) Hygromycin B phosphotransferase Hygromycin-B kinase
Unit:	1 mg
price :	Consultar
format :	Liquid or Lyophilized powder
note :	Escherichia coli
Aa sequence :	MKKPELTATSVEKFLIEKFDSVSDLMQLSEGEESRAFSFDVGGRGYVLRVNSCADGFYKDRYVYRHFASAALPIPEVLDIGEFSESLTYCISRRAQGVTLQDLPETELPAVLQPVAEAMDAIAAADLSQTSGFGPFGPQGIGQYTTWRDFICAIADPHVYHWQTVMDDTVSASVAQALDELMLWAEDCPEVRHLVHADFGSNNVLTDNGRITAVIDWSEAMFGDSQYEVANIFFWRPWLACMEQQTRYFERRHPE
buffer :	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Immunogen sequence :	1-341aa
purity :	Greater than 85% as determined by SDS-PAGE.
endotoxin :	Not test.
tag :	N-terminal 6xHis-tagged
Molecular weight :	42 kDa
Uniprot number :	P00557