Product - Abyntek Biopharma

Protein

Recombinant Mesobuthus martensii Beta-insect depressant toxin BmKITa, partial

DESCRIPCIÓN

Supplier:	Biorbyt
Reference:	orb1785584
Name:	Recombinant Mesobuthus martensii Beta-insect depressant toxin BmKITa, partial
Category:	Protein
Subcategory:	Proteins
Aditional Names:	(BmK ITa)(BmK dITAP3)
Unit:	20 ug
price :	Consultar
format :	Liquid or Lyophilized powder
note :	Mesobuthus martensii (Manchurian scorpion) (Buthus martensii)
Aa sequence :	DGYIRGSNGCKVSCLWGNEGCNKECRAYGASYGYCWTWGLACWCQGLPDDKTWKSESNTCG
buffer :	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
purity :	Greater than 90% as determined by SDS-PAGE.
endotoxin :	Not test.
tag :	N-terminal 10xHis-tagged
Molecular weight :	12.8 kDa
Uniprot number :	Q9XY87