Product - Abyntek Biopharma

Protein

Human CASP14 protein

DESCRIPCIÓN

Supplier:	Biorbyt
Reference:	orb382944
Name:	Human CASP14 protein
Category:	Protein
Subcategory:	Proteins
Aditional Names:	Apoptosis related cysteine protease, CASP 14, CASP-14, CASP14, Caspase 14 apoptosis related cysteine protease, Caspase 14 precursor, Caspase-14 subunit p10, Caspase14, CASPE_HUMAN, MGC119078, MGC119079, MICE, Mini ICE
Unit:	1 mg
price :	Consultar
format :	Liquid or Lyophilized powder
note :	Homo sapiens (Human)
Aa sequence :	KDSPQTIPTYTDALHVYSTVEGYIAYRHDQKGSCFIQTLVDVFTKRKGHILELLTEVTRRMAEAELVQEGKARKTNPEIQSTLRKRLY
buffer :	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Immunogen sequence :	153-240aa
purity :	Greater than 90% as determined by SDS-PAGE.
endotoxin :	Not test.
tag :	N-terminal GST-tagged
Molecular weight :	37.2 kDa
Uniprot number :	P31944