Product - Abyntek Biopharma

Protein

Human MMP14 protein

DESCRIPCIÓN

Supplier:	Biorbyt
Reference:	orb382962
Name:	Human MMP14 protein
Category:	Protein
Subcategory:	Proteins
Aditional Names:	MMP-X1Membrane-type matrix metalloproteinase 1 , MT-MMP 1 , MTMMP1Membrane-type-1 matrix metalloproteinase , MT1-MMP , MT1MMP
Unit:	100 ug
price :	Consultar
format :	Liquid or Lyophilized powder
note :	Homo sapiens (Human)
Aa sequence :	YAIQGLKWQHNEITFCIQNYTPKVGEYATYEAIRKAFRVWESATPLRFREVPYAYIREGHEKQADIMIFFAEGFHGDSTPFDGEGGFLAHAYFPGPNIGGDTHFDSAEPWTVRNEDLNGNDIFLVAVHELGHALGLEHSSDPSAIMAPFYQWMDTENFVLPDDDRRGIQQLYGGESGFPTKMPPQPRTTSRPSVPDKPKNPTYGPNICDGNFDTVAMLRGEMFVFKERWFWRVRNNQVMDGYPMPIGQFWRGLPA
buffer :	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Immunogen sequence :	112-582aa
purity :	Greater than 90% as determined by SDS-PAGE.
endotoxin :	Not test.
tag :	N-terminal 6xHis-SUMO-tagged
Molecular weight :	69.9 kDa
Uniprot number :	P50281