Product - Abyntek Biopharma

Protein

Mouse EGF protein

DESCRIPCIÓN

Supplier:	Abbkine
Reference:	PRP1142
Name:	Mouse EGF protein
Category:	Protein
Subcategory:	Cytokine
Aditional Names:	Urogastrone, URG
Unit:	100 ug 500 ug 1000 ug 10 mg
price :	Consultar
format :	The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us.
description :	Epidermal Growth Factors (EGF) is a member of the EGF-family of proteins. EGF is mainly secreted from ectodermal cells, monocytes, kidney and duodenal glands. Upon binding to its receptor, EGFR, EGF acts to stimulate cell growth and proliferation of epith
Storage conditions :	Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein
Immunogen sequence :	MNSYPGCPSSYDGYCLNGGVCMHIESLDSYTCNCVIGYSGDRCQTRDLRWWELR with polyhistidine tag at the C-terminus.
purity :	>98% as determined by SDS-PAGE.
tag :	EGF
Molecular weight :	The protein has a calculated MW of 6.98 kDa. The protein migrates as 8 kDa under reducing condition (SDS-PAGE analysis).