Product - Abyntek Biopharma

Protein

Recombinant Blomia tropicalis Mite allergen Blo t 5 (BLOT5)

DESCRIPCIÓN

Supplier:	Biomatik
Reference:	RPC22918
Name:	Recombinant Blomia tropicalis Mite allergen Blo t 5 (BLOT5)
Category:	Protein
Subcategory:	Recombinant Protein
Aditional Names:	Allergen: Blo t 5
Unit:	20ug 100ug 1mg
conjugation :	Unconjugated
price :	Consultar
reactivity :	Other
Storage conditions :	-20°C. Avoid repeated freeze/thaw cycles.
Aa sequence :	MKFAIVLIACFAASVLAQEHKPKKDDFRNEFDHLLIEQANHAIEKGEHQLLYLQHQLDELNENKSKELQEKIIRELDVVCAMIEGAQGALERELKRTDLNILERFNYEEAQTLSKILLKDLKETEQKVKDIQTQ
buffer :	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
purity :	>90% as determined by SDS-PAGE
endotoxin :	Not Tested
tag :	N-Terminal 6Xhis-Sumo-Tagged
Expiry date :	12 months
Molecular weight :	31.6kDa
bioactivity :	Not Tested