Product - Abyntek Biopharma

Protein

Recombinant Bovine coronavirus Spike glycoprotein (S), partial

DESCRIPCIÓN

Supplier:	Biomatik
Reference:	RPC27977
Name:	Recombinant Bovine coronavirus Spike glycoprotein (S), partial
Category:	Protein
Subcategory:	Recombinant Protein; Coronavirus Protein
Research Area:	Microbiology
Aditional Names:	S glycoprotein; E2; Peplomer protein
Unit:	20ug 100ug 1mg
conjugation :	Unconjugated
price :	Consultar
reactivity :	Bovine coronavirus (strain LY-138) (BCoV) (BCV)
Storage conditions :	-20°C. Avoid repeated freeze/thaw cycles.
Aa sequence :	TVQPIADVYRRIPNLPDCNIEAWLNDKSVPSPLNWERKTFSNCNFNMSSLMSFIQADSFTCNNIDAAKIYGMCFSSITIDKFAIPNGRKVDLQLGNLGYLQSFNYRIDTTATSCQLYYNLPAANVSVSRFNPSTWNRRFGFTEQSVFKPQPVGVFTDHDVVYAQHCFKAPTNFCPCKLDGSLCVGSGSGIDAGYKNSGIGTCPAGTNYLTCHNAAQCDCLCTPDPITSKSTGPYKCPQTKYLVGIGEHCSGLAIK
buffer :	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
purity :	>90% as determined by SDS-PAGE
endotoxin :	Not Tested
tag :	C-Terminal 6Xhis-Tagged
Expiry date :	12 months
Molecular weight :	36.6kDa
bioactivity :	Not Tested