Product - Abyntek Biopharma

Protein

Severe acute respiratory syndrome coronavirus 3C-like proteinase

DESCRIPCIÓN

Supplier:	Biomatik
Reference:	RPC27984
Name:	Severe acute respiratory syndrome coronavirus 3C-like proteinase
Category:	Protein
Subcategory:	CF Transmembrane Protein; Coronavirus Protein
Aditional Names:	Growth factor-like peptide; Leader protein; Non-structural protein 10; Non-structural protein 2; Non-structural protein 3; Non-structural protein 4; Non-structural protein 6; Non-structural protein 7; Non-structural protein 8; Non-structural protein 9; Papain-like proteinase; p65 homolog
Unit:	20ug 100ug
conjugation :	Unconjugated
price :	Consultar
reactivity :	Severe acute respiratory syndrome coronavirus (SAR
Storage conditions :	-20°C. Avoid repeated freeze/thaw cycles.
Aa sequence :	GKFKKIVKGTHHWMLLTFLTSLLILVQSTQWSLFFFVYENAFLPFTLGIMAIAACAMLLVKHKHAFLCLFLLPSLATVAYFNMVYMPASWVMRIMTWLELADTSLSGYRLKDCVMYASALVLLILMTARTVYDDAARRVWTLMNVITLVYKVYYGNALDQAISMWALVISVTSNYSGVVTTIMFLARAIVFVCVEYYPLLFITGNTLQCIMLVYCFLGYCCCCYFGLFCLLNRYFRLTLGVYDYLVSTQEFRYMN
buffer :	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
purity :	>85% as determined by SDS-PAGE
endotoxin :	Not Tested
tag :	N-Terminal 10Xhis-Tagged
Expiry date :	12 months
Molecular weight :	35.8kDa
bioactivity :	Not Tested