Product - Abyntek Biopharma

Protein

Recombinant Human Angiopoietin-2 (ANGPT2), partial

DESCRIPCIÓN

Supplier:	Biomatik
Reference:	RPC28319
Name:	Recombinant Human Angiopoietin-2 (ANGPT2), partial
Category:	Protein
Subcategory:	Recombinant Protein
Research Area:	Cardiovascular
Aditional Names:	AGPT 2; Agpt2; ANG 2; ANG-2; ANG2; Angiopoietin 2a; Angiopoietin 2B; Angiopoietin-2; Angiopoietin2; ANGP2_HUMAN; ANGPT 2; Angpt2; Tie2 ligand
Unit:	20ug 100ug 1mg
conjugation :	Unconjugated
price :	Consultar
reactivity :	Human (Homo sapiens)
Storage conditions :	-20°C. Avoid repeated freeze/thaw cycles.
Aa sequence :	YNNFRKSMDSIGKKQYQVQHGSCSYTFLLPEMDNCRSSSSPYVSNAVQRDAPLEYDDSVQRLQVLENIMENNTQWLMKLENYIQDNMKKEMVEIQQNAVQNQTAVMIEIGTNLLNQTAEQTRKLTDVEAQVLNQTTRLELQLLEHSLSTNKLEKQILDQTSEINKLQDKNSFLEKKVLAMEDKHIIQLQSIKEEKDQLQVLVSKQNSIIEELEKKIVTATVNNSVLQKQQHDLMETVNNLLTMMSTSNSAKDPTV
buffer :	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
purity :	>90% as determined by SDS-PAGE
endotoxin :	Not Tested
tag :	N-Terminal 6Xhis-Tagged
Expiry date :	12 months
Molecular weight :	57.7kDa
bioactivity :	Not Tested