Product - Abyntek Biopharma

Protein

Recombinant Bovine coronavirus Non-structural protein of 12.7 kDa (5a)

DESCRIPCIÓN

Supplier:	Biomatik
Reference:	RPC28016
Name:	Recombinant Bovine coronavirus Non-structural protein of 12.7 kDa (5a)
Category:	Protein
Subcategory:	Recombinant Protein; Coronavirus Protein
Research Area:	Microbiology
Aditional Names:	ns12.7; 12.7 kDa accessory protein
Unit:	20ug 100ug 1mg
conjugation :	Unconjugated
price :	Consultar
reactivity :	Bovine coronavirus (strain 98TXSF-110-LUN) (BCoV-L
Storage conditions :	-20°C. Avoid repeated freeze/thaw cycles.
Aa sequence :	MDIWKPEIKYLRYTNGFNVSELEDACFKFNYKFPKVGYCRVPSHAWCRNQGSFCATLTLYGKSKHYDKYFGVITGFTAFANTVEEAVNKLVFLAVDFITWRRQELNVHG
buffer :	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
purity :	>85% as determined by SDS-PAGE
endotoxin :	Not Tested
tag :	C-Terminal 6Xhis-Tagged
Expiry date :	12 months
Molecular weight :	18.2kDa
bioactivity :	Not Tested