Product - Abyntek Biopharma

Protein

Recombinant Arabidopsis thaliana NADPH-dependent oxidoreductase 2-alkenal reductase (AER)

DESCRIPCIÓN

Supplier:	Biomatik
Reference:	RPC28279
Name:	Recombinant Arabidopsis thaliana NADPH-dependent oxidoreductase 2-alkenal reductase (AER)
Category:	Protein
Subcategory:	Recombinant Protein
Aditional Names:	AER; P1; At5g16970; F2K13_120; NADPH-dependent oxidoreductase 2-alkenal reductase; AtAER; EC 1.3.1.-; EC 1.3.1.74; NADP-dependent alkenal double bond reductase P1; DBR1; NADPH-azodicarbonyl/quinone reductase; NADPH:2-alkenal/one alpha,beta-hydrogenase; ALH; P1-zeta-crystallin protein; P1-ZCr
Unit:	20ug 100ug 1mg
conjugation :	Unconjugated
price :	Consultar
reactivity :	Arabidopsis thaliana (Mouse-ear cress)
Storage conditions :	-20°C. Avoid repeated freeze/thaw cycles.
Aa sequence :	MTATNKQVILKDYVSGFPTESDFDFTTTTVELRVPEGTNSVLVKNLYLSCDPYMRIRMGKPDPSTAALAQAYTPGQPIQGYGVSRIIESGHPDYKKGDLLWGIVAWEEYSVITPMTHAHFKIQHTDVPLSYYTGLLGMPGMTAYAGFYEVCSPKEGETVYVSAASGAVGQLVGQLAKMMGCYVVGSAGSKEKVDLLKTKFGFDDAFNYKEESDLTAALKRCFPNGIDIYFENVGGKMLDAVLVNMNMHGRIAVCG
buffer :	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
purity :	>90% as determined by SDS-PAGE
endotoxin :	Not Tested
tag :	Tag-Free
Expiry date :	12 months
Molecular weight :	38.1kDa
bioactivity :	Not Tested