Product - Abyntek Biopharma

Protein

Recombinant Human 5-hydroxytryptamine receptor 1D (HTR1D), partial

DESCRIPCIÓN

Supplier:	Biomatik
Reference:	RPC28723
Name:	Recombinant Human 5-hydroxytryptamine receptor 1D (HTR1D), partial
Category:	Protein
Subcategory:	Recombinant Protein
Aditional Names:	5-hydroxytryptamine receptor 1D(5-HT-1D; 5-HT1D; Serotonin 1D alpha receptor; 5-HT-1D-alpha; Serotonin receptor 1D)
Unit:	20ug 100ug 1mg
conjugation :	Unconjugated
price :	Consultar
reactivity :	Human (Homo sapiens)
Storage conditions :	-20°C. Avoid repeated freeze/thaw cycles.
Aa sequence :	MSPLNQSAEGLPQEASNRSLNATETSEAWDPRTLQALK
buffer :	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
purity :	>85% as determined by SDS-PAGE
endotoxin :	Not Tested
tag :	N-Terminal 6Xhis-Ksi-Tagged
Expiry date :	12 months
Molecular weight :	19.5kDa
bioactivity :	Not Tested