Product - Abyntek Biopharma

Protein

Recombinant Mouse EEF1A lysine methyltransferase 2 (Eef1akmt2)

DESCRIPCIÓN

Supplier:	Biomatik
Reference:	RPC28724
Name:	Recombinant Mouse EEF1A lysine methyltransferase 2 (Eef1akmt2)
Category:	Protein
Subcategory:	Recombinant Protein
Aditional Names:	EEF1A lysine methyltransferase 2(EC 2.1.1.-; Methyltransferase-like protein 10; Protein-lysine N-methyltransferase Mettl10)
Unit:	20ug 100ug 1mg
conjugation :	Unconjugated
price :	Consultar
reactivity :	Mouse (Mus musculus)
Storage conditions :	-20°C. Avoid repeated freeze/thaw cycles.
Aa sequence :	MNADAEGHSGAVVPAQSPEGSSAADDFVPSALGTREHWDAVYERELRTFQEYGDTGEIWFGEESMNRLIRWMQKHKIPLDASVLDIGTGNGVFLVELVKHGFSNITGIDYSPSAIKLSASILEKEGLSNINLKVEDFLNPSTKLSGFHVCVDKGTYDAISLNPDNAIEKRKQYVMSLSRVLEVKGFFLITSCNWTKAELLDAFSEGFELFEELPTPKFSFGGRSGNTVAALVFQKRGTSLDKIS
buffer :	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
purity :	>85% as determined by SDS-PAGE
endotoxin :	Not Tested
tag :	N-Terminal 10Xhis-Tagged
Expiry date :	12 months
Molecular weight :	32.9kDa
bioactivity :	Not Tested