Product - Abyntek Biopharma

Protein

Recombinant Human Interferon regulatory factor 1 (IRF1)

DESCRIPCIÓN

Supplier:	Biomatik
Reference:	RPC28563
Name:	Recombinant Human Interferon regulatory factor 1 (IRF1)
Category:	Protein
Subcategory:	Recombinant Protein
Research Area:	Cardiovascular
Aditional Names:	Interferon regulatory factor 1; Interferon regulatory factor 1 isoform +I9; Interferon regulatory factor 1 isoform d78; Interferon regulatory factor 1 isoform delta4; Interferon regulatory factor 1 isoform delta7; IRF 1; IRF-1; IRF1; IRF1_HUMAN; MAR; MAR1
Unit:	20ug 100ug 1mg
conjugation :	Unconjugated
price :	Consultar
reactivity :	Human (Homo sapiens)
Storage conditions :	-20°C. Avoid repeated freeze/thaw cycles.
Aa sequence :	MPITRMRMRPWLEMQINSNQIPGLIWINKEEMIFQIPWKHAAKHGWDINKDACLFRSWAIHTGRYKAGEKEPDPKTWKANFRCAMNSLPDIEEVKDQSRNKGSSAVRVYRMLPPLTKNQRKERKSKSSRDAKSKAKRKSCGDSSPDTFSDGLSSSTLPDDHSSYTVPGYMQDLEVEQALTPALSPCAVSSTLPDWHIPVEVVPDSTSDLYNFQVSPMPSTSEATTDEDEEGKLPEDIMKLLEQSEWQPTNVDGKG
buffer :	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
purity :	>85% as determined by SDS-PAGE
endotoxin :	Not Tested
tag :	N-Terminal 10Xhis-Tagged And C-Terminal Gst-Tagged
Expiry date :	12 months
Molecular weight :	65.5kDa
bioactivity :	Not Tested