Product - Abyntek Biopharma

Protein

Recombinant Human Inter-alpha-trypsin inhibitor heavy chain H3 (ITIH3), partial

DESCRIPCIÓN

Supplier:	Biomatik
Reference:	RPC28740
Name:	Recombinant Human Inter-alpha-trypsin inhibitor heavy chain H3 (ITIH3), partial
Category:	Protein
Subcategory:	Recombinant Protein
Aditional Names:	Inter-alpha-trypsin inhibitor heavy chain H3(ITI heavy chain H3; ITI-HC3; Inter-alpha-inhibitor heavy chain 3; Serum-derived hyaluronan-associated protein; SHAP)
Unit:	20ug 100ug 1mg
conjugation :	Unconjugated
price :	Consultar
reactivity :	Human (Homo sapiens)
Storage conditions :	-20°C. Avoid repeated freeze/thaw cycles.
Aa sequence :	MNSFKADVKGHGATNDLTFTEEVDMKEMEKALQERDYIFGNYIERLWAYLTIEQLLEKRKNAHGEEKENLTARALDLSLKYHFVTPLTSMVVTKPEDNEDERAIADKPGEDAEATPVSPAMSYLTSYQPPQNPYYYVDGD
buffer :	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
purity :	>85% as determined by SDS-PAGE
endotoxin :	Not Tested
tag :	N-Terminal 10Xhis-Gst-Tagged And C-Terminal Myc-Tagged
Expiry date :	12 months
Molecular weight :	51.2kDa
bioactivity :	Not Tested