Product - Abyntek Biopharma

Protein

Recombinant Human FGF2 Protein

DESCRIPCIÓN

Supplier:	Boster
Reference:	R00121
Name:	Recombinant Human FGF2 Protein
Category:	Protein
Subcategory:	Recombinant Proteins
Unit:	100?g/vial
price :	Consultar
format :	Lyophilized
reactivity :	Human
description :	Fibroblast Growth Factor basic (FGF-basic/FGF-2) is a single-chain polypeptide growth factor that plays a significant role in the process of wound healing and is a potent inducer of angiogenesis. Several different forms of the human protein exist ranging
purification :	>95%, by SDS-PAGE quantitative densitometry by Coomassie® Blue Staining.
Storage conditions :	Lyophilized recombinant mouse Fibroblast Growth Factor basic (FGF-basic/FGF-2) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, rhFGF2 remains stable up to 2 weeks at 4°C or up to 3 months at -20°C.
Aa sequence :	PALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
Gene name :	FGF2
Molecular weight :	16.5KD
Uniprot number :	P09038