Product - Abyntek Biopharma

Protein

IL-13 Interleukin-13 Human Recombinant Protein

DESCRIPCIÓN

Supplier:	Boster
Reference:	PROTP35225
Name:	IL-13 Interleukin-13 Human Recombinant Protein
Category:	Protein
Subcategory:	Recombinant Proteins
Aditional Names:	NC30; ALRH; BHR1; P600; IL-13; MGC116786; MGC116788; MGC116789
Unit:	2ug 10ug 1mg
price :	Consultar
format :	Sterile Filtered White lyophilized (freeze-dried) powder.
reactivity :	Human
description :	Interleukin-13 Human Recombinant produced in E. coli is a single, non-glycosylated polypeptide chain containing 112 amino acids and having a molecular mass of 12 kDa. The IL-13 is purified by proprietary chromatographic techniques.
Cell localization :	Secreted.
purification :	Greater than 95% as determined by (a) Analysis by RP-HPLC and (b) Analysis by SDS-PAGE.
Storage conditions :	Lyophilized Interleukin-13 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IL13 should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended t
Aa sequence :	GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVS GCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFRE GRFN
Gene name :	IL13
bioactivity :	The ED50 was determined by the dose dependent prolifiration of TF-1 cells and was found to be less than 1ng/ml, corresponding to a specific activity of greater than 1 x 106units/mg.
Uniprot number :	P35225