Product - Abyntek Biopharma

Protein

IL17F Interleukin-17F Mouse Recombinant Protein

DESCRIPCIÓN

Supplier:	Boster
Reference:	PROTQ7TNI7
Name:	IL17F Interleukin-17F Mouse Recombinant Protein
Category:	Protein
Subcategory:	Recombinant Proteins
Aditional Names:	Cytokine ML-1; IL-17F; Interleukin-17F precursor; IL17F; ML1; ML-1
Unit:	5ug 25ug 1mg
price :	Consultar
format :	Sterile Filtered White lyophilized (freeze-dried) powder.
reactivity :	Mouse
description :	IL17F Mouse Recombinant produced in E. coli is a homodimeric, non-glycosylated polypeptide chain containing a total of 266 amino acids and having a molecular mass of 29.8 kDa. The Mouse IL-17F is purified by proprietary chromatographic techniques.
Cell localization :	Secreted
purification :	Greater than 97.0% as determined by (a) Analysis by RP-HPLC and (b) Analysis by SDS-PAGE.
Storage conditions :	Lyophilized Murine IL17F although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IL17F should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to
Aa sequence :	RKNPKAGVPALQKAGNCPPLEDNTVRVDIRIFNQNQGISVPREFQNRSSSP WDYNITRDPHRFPSEIAEAQCRHSGCINAQGQEDSTMNSVAIQQEILVLRR EPQGCSNSFRLEKMLLKVGCTCVKPIVHQAA
Gene name :	IL17F
Uniprot number :	Q7TNI7