Product - Abyntek Biopharma

Protein

IP-10 Human Recombinant Protein (CXCL10)

DESCRIPCIÓN

Supplier:	Boster
Reference:	PROTP02778
Name:	IP-10 Human Recombinant Protein (CXCL10)
Category:	Protein
Subcategory:	Recombinant Proteins
Aditional Names:	Small inducible cytokine B10; CXCL10; 10 kDa; Gamma-IP10; IP-10; chemokine (C-X-C motif) ligand 10; C7; IFI10; INP10; crg-2; mob-1; SCYB10; gIP-10
Unit:	5ug 25ug 1mg
price :	Consultar
format :	Sterile Filtered White lyophilized (freeze-dried) powder.
reactivity :	Human
description :	IP-10 Human Recombinant produced in E. coli is a single, non-glycosylated, polypeptide chain containing 77 amino acids and having a molecular mass of 8.6kDa. The IP-10 is purified by proprietary chromatographic techniques.
Cell localization :	Secreted.
purification :	Greater than 95.0% as determined by SDS-PAGE.
Storage conditions :	Lyophilized IP-10 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution CXCL10 should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a
Aa sequence :	VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKA IKNLLKAVSKERSKRSP
Gene name :	CXCL10
Uniprot number :	P02778