Product - Abyntek Biopharma

Protein

MOG Myelin Oligodendrocyte Glycoprotein Human Recombinant Protein

DESCRIPCIÓN

Supplier:	Boster
Reference:	PROTQ16653
Name:	MOG Myelin Oligodendrocyte Glycoprotein Human Recombinant Protein
Category:	Protein
Subcategory:	Recombinant Proteins
Aditional Names:	Myelin Oligodendrocyte Glycoprotein; MOG; MOGIG-2; MGC26137
Unit:	10ug 50ug 1mg
price :	Consultar
format :	Sterile Filtered White lyophilized (freeze-dried) powder.
description :	Myelin Oligodendrocyte Glycoprotein produced in E. coli is a single, non-glycosylated polypeptide chain containing a total of 132 amino acids (Met + 30-154 a.a. + 6x His tag at C-terminus) and having a total molecular mass of 15.2 kDa.
Cell localization :	Isoform 1: Cell membrane
purification :	Greater than 95.0% as determined by SDS-PAGE.
Storage conditions :	Lyophilized MOG although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution MOG should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a car
Aa sequence :	MGQFRVIGPRHPIRALVGDEVELPCRISPGKNATGMEVGWYRPPFSRVVHLYRN GKDQDGDQAPEYRGRTELLKDAIGEGKVTLRIRNVRFSDEGGFTCFFRDHSYQE EAAMELKVEDPFYWVSPGHHHHHH
Gene name :	MOG
Uniprot number :	Q16653