Product - Abyntek Biopharma

Protein

RB1 Retinoblastoma Associated Protein Human Recombinant Protein

DESCRIPCIÓN

Supplier:	Boster
Reference:	PROTP06400
Name:	RB1 Retinoblastoma Associated Protein Human Recombinant Protein
Category:	Protein
Subcategory:	Recombinant Proteins
Aditional Names:	RB; OSRC; RB-1; RB1; p105-Rb; OSTEOSARCOMA; RETINOBLASTOMA-RELATED;PP110; Retinoblastoma-associated protein
Unit:	10ug 50ug 1mg
price :	Consultar
format :	Sterile Filtered White lyophilized (freeze-dried) powder.
reactivity :	Human
description :	Retinoblastoma Human Recombinant fused with 6X His tag produced in E. coli is a single, non-glycosylated, polypeptide chain containing 146 amino acids and having a molecular mass of 16.5 kDa. The Retinoblastoma is purified by proprietary chromatographic t
Cell localization :	Nucleus
purification :	Greater than 95.0% as determined by (a) Analysis by RP-HPLC and (b) Analysis by SDS-PAGE.
Storage conditions :	Lyophilized Retinoblastoma although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Retinoblastoma should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is rec
Aa sequence :	MASFPSSPLRIPGGNIYISPLKSPYKISEGLPTPTKMTPRSRILVSIGESFG TSEKFQKINQMVCNSDRVLKRSAEGSNPPKPLKKLRFDIEGSDEADGSK HLPGESKFQQKLAEMTSTRTRMQKQKMNDSMDTSNKEEKHHHHHH
Gene name :	RB1
Uniprot number :	P06400