Product - Abyntek Biopharma

Protein

BAFF-R B-cell Activating Factor Receptor Human Recombinant Protein

DESCRIPCIÓN

Supplier:	Boster
Reference:	PROTQ96RJ3
Name:	BAFF-R B-cell Activating Factor Receptor Human Recombinant Protein
Category:	Protein
Subcategory:	Recombinant Proteins
Aditional Names:	TNFRSF13C; CD268; BAFF-R; MGC138235; B cell-activating factor receptor
Unit:	10ug 50ug 1mg
price :	Consultar
format :	Sterile Filtered White lyophilized (freeze-dried) powder.
reactivity :	Human
description :	B Lymphocyte Stimulator Receptor Human Recombinant extracellular produced in E. coli is a single, non-glycosylated polypeptide chain containing 76 amino acids and having a molecular mass of 7.7 kDa. The BAFF-R is purified by proprietary chromatographic te
Cell localization :	Membrane
purification :	Greater than 95.0% as determined by (a) Analysis by RP-HPLC and (b) Analysis by SDS-PAGE.
Storage conditions :	Lyophilized BAFF-R although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution B Lymphocyte Stimulator Receptor should be stored at 4°C between 2-7 days and for future use below -18°C.Please prevent freeze
Aa sequence :	MRRGPRSLRGRDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAG ASSPAPRTALQPQESVGAGAGEAALPLPG
Gene name :	TNFRSF13C
bioactivity :	Determined by its ability to block BAFF induced mouse splenocyte survival. The expected ED50 for this effect is 1.0-5.0 µg/ml in the presence of 1.0µg/ml of human soluble BAFF.
Uniprot number :	Q96RJ3