Product - Abyntek Biopharma

Protein

BMP-7 Bone Morphogenetic Protein-7 Human Recombinant Protein, Plant

DESCRIPCIÓN

Supplier:	Boster
Reference:	PROTP18075
Name:	BMP-7 Bone Morphogenetic Protein-7 Human Recombinant Protein, Plant
Category:	Protein
Subcategory:	Recombinant Proteins
Aditional Names:	Osteogenic Protein 1; BMP-7
Unit:	2ug 10ug 1mg
price :	Consultar
format :	Sterile Filtered White lyophilized (freeze-dried) powder.
reactivity :	Human
description :	Bone Morphogenetic Protein-7 Human Recombinant produced in Plant is a monomeric, glycosylated, polypeptide chain containing 144 amino acids and having a molecular mass of 16.5kDa, and fused to a 6xHis-tag at the N-terminus. The BMP-7 is purified by propri
Cell localization :	Secreted.
purification :	Greater than 97.0% as determined by SDS-PAGE.
Storage conditions :	Lyophilized BMP-7 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution BMP 7 Human should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to
Aa sequence :	HHHHHHSTGSKQRSQNRSKTPKNQEALRMANVAEN SSSDQRQACKKHELYVSFRDLGWQDWIIAPEGYAAY YCEGECAFPLNSYMNATNHAIVQTLVHFINPETVPKP CCAPTQLNAISVLYFDDSSVILKKYRNMVVRACGCH
Gene name :	BMP7
bioactivity :	The biological activity of BMP-7 was measured by its ability to induce alkaline phosphatase production by ATDC5 cells, ED50 is less than 40ng/ml, corresponding to a specific activity of 25,000 units/mg.
Uniprot number :	P18075