Product - Abyntek Biopharma

Protein

MX1 Myxovirus Resistance 1 Bovine Recombinant Protein

DESCRIPCIÓN

Supplier:	Boster
Reference:	PROTP79135
Name:	MX1 Myxovirus Resistance 1 Bovine Recombinant Protein
Category:	Protein
Subcategory:	Recombinant Proteins
Aditional Names:	Interferon-induced GTP-binding protein Mx1; Myxoma resistance protein 1; Myxovirus resistance protein 1; MX1; Interferon-Induced Protein P78; IFI-78K; IFI78; MxA
Unit:	5ug 20ug 1mg
price :	Consultar
format :	Sterile Filtered White lyophilized (freeze-dried) powder.
reactivity :	Goat
description :	MX1 Bovine Recombinant fused with a 20 amino acid His tag at N-terminus produced in E. coli is a single, non-glycosylated, polypeptide chain (1-648 a.a) containing a total of 668 amino acids and having a molecular mass of 77kDa. The MX1 is purified by pro
Cell localization :	Cytoplasm
purification :	Greater than 90.0% as determined by (a) Analysis by RP-HPLC and (b) Analysis by SDS-PAGE.
Storage conditions :	Lyophilized MX1 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution MX1 should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a car
Aa sequence :	MVHSDLGIEELDSPESSLNGSEDMESKSNLYSQYEEKVRPCID LIDSLRSLGVEQDLALPAIAVIGDQSSGKSSVLEALSGVALPRGSGIVTRCPLVLRLKKLGNE DEWKGKVSFLDKEIEIPDASQVEKEISEAQIAIAGEGTGISHELISLEVSSPHVPDLTLIDLP GITRVAVGNQPPDIEYQIKSLIRKYILRQETINLVVVPANVDIATTEALRMAQEVDPQGD
Gene name :	MX1
Uniprot number :	P79135