Product - Abyntek Biopharma

Protein

NRG1 Heregulin-B2 Human Recombinant Protein

DESCRIPCIÓN

Supplier:	Boster
Reference:	PROTQ02297
Name:	NRG1 Heregulin-B2 Human Recombinant Protein
Category:	Protein
Subcategory:	Recombinant Proteins
Aditional Names:	Neuregulin-1; NRG1; GGF; HGL; HRGA; NDF; SMDF; HRG; ARIA; GGF2; HRG1
Unit:	10ug 50ug 1mg
price :	Consultar
format :	Sterile Filtered White lyophilized (freeze-dried) powder.
reactivity :	Human
description :	Recombinant Human Neuregulin-1 beta 2 produced in E. coli is a single, non-glycosylated, polypeptide chain containing 61 amino acids and having a total molecular mass of 7.0kDa. NRG-1 is purified by proprietary chromatographic techniques.
Cell localization :	Pro-neuregulin-1, membrane-bound isoform: Cell membrane; Single-pass type I membrane protein. Does not seem to be active.
purification :	Greater than 96.0% as determined by (a) Analysis by RP-HPLC and (b) Analysis by SDS-PAGE.
Storage conditions :	Lyophilized NRG1 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Heregulin should be stored at 4°C between 2-7 days and for future use below -18°C.Please prevent freeze-thaw cycles.
Aa sequence :	SHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCPNEFTGDRCQNYVMASFYKAEELYQ
Gene name :	NRG1
bioactivity :	The ED50 as determined by a cell proliferation assay using serum free human MCF-7 cells is less than 50ng/ml, corresponding to a specific activity of greater than 2.0 × 104 IU/mg.
Uniprot number :	Q02297