Product - Abyntek Biopharma

Protein

HLA-DQB2 (NM_001198858) Human Recombinant Protein

DESCRIPCIÓN

Supplier:	Boster
Reference:	PROTP05538
Name:	HLA-DQB2 (NM_001198858) Human Recombinant Protein
Category:	Protein
Subcategory:	Recombinant Proteins
Unit:	20ug
Concentration:	>50 ug/mL as determined by microplate BCA method
price :	Consultar
format :	Frozen Solution in PBS Buffer
description :	Purified recombinant protein of Homo sapiens major histocompatibility complex, class II, DQ beta 2 (HLA-DQB2).
purification :	> 80% as determined by SDS-PAGE and Coomassie blue staining
Storage conditions :	Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Aa sequence :	MALQIPGGFWAAAVTVMLVMLSTPVAEARDFPKDFLVQFKGMCYFTNGTERVRGVARYIYNREEYGRFDSDVGEFQAVTELGRSIEDWNNYKDFLEQERAAVDKVCRHNYEAELRTTLQRQVEPTVTISPSRTEALNHHNLLVCSVTDFYPAQIKVRWFRNDQEETAGVVSTSLIRNGDWTFQILVMLEITPQRGDIYTCQVEHPSLQSPITVEWRPRGPPPAGLLH
tag :	C-Myc/DDK
Gene name :	HLA-DQB2
Molecular weight :	26,5
Uniprot number :	P05538