Product - Abyntek Biopharma

Protein

APLP2 (NM_001142277) Human Recombinant Protein

DESCRIPCIÓN

Supplier:	Boster
Reference:	PROTQ06481
Name:	APLP2 (NM_001142277) Human Recombinant Protein
Category:	Protein
Subcategory:	Recombinant Proteins
Unit:	20ug
Concentration:	>50 ug/mL as determined by microplate BCA method
price :	Consultar
format :	Frozen Solution in PBS Buffer
description :	Recombinant protein of human amyloid beta (A4) precursor-like protein 2 (APLP2), transcript variant 3
purification :	> 80% as determined by SDS-PAGE and Coomassie blue staining
Storage conditions :	Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Aa sequence :	MAATGTAAAAATGRLLLLLLVGLTAPALALAGYIEALAANAGTGFAVAEPQIAMFCGKLNMHVNIQTGKWEPDPTGTKSCFETKEEVLQYCQEMYPELQITNVMEANQRVSIDNWCRRDKKQCKSRFVTPFKCLVGEFVSDVLLVPEKCQFFHKERMEVCENHQHWHTVVKEACLTQGMTLYSYGMLLPCGVDQFHGTEYVCCPQTKIIGSVSKEEEEEDEEEEEEEDEEEDYDVYKSEFPTEADLEDFTEAAVD
tag :	C-Myc/DDK
Gene name :	APLP2
Molecular weight :	79.1 kDa
Uniprot number :	Q06481