Product - Abyntek Biopharma

Protein

Recombinant Human CD24 Fc Chimera Protein, Insect Cells Derived

DESCRIPCIÓN

Supplier:	Signalway
Reference:	AP60513
Name:	Recombinant Human CD24 Fc Chimera Protein, Insect Cells Derived
Category:	Protein
Subcategory:	Proteins with activity
Unit:	5ug 100ug 500ug
price :	Consultar
format :	Lyophilized from a 0.2 ?m filtered concentrated solution in PBS.
purification :	> 95 % by SDS-PAGE analyses.
Storage conditions :	Use a manual defrost freezer and avoid repeated freeze-thaw cycles.- 12 months from date of receipt, -20 to -70 ? as supplied.- 1 month, 2 to 8 ? under sterile conditions after reconstitution.- 3 months, -20 to -70 ? under sterile conditions after reconst
Aa sequence :	AGMGMSETTTGTSSNSSQSTSNSGLAPNPTNATTKAAGIEGRMDEPKSSDKTHTCPPCPAPEFEGAPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPTPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCS
endotoxin :	Less than 0.1 EU/ugof rHuCD24-Fc as determined by LAL method.
Molecular weight :	The protein has a calculated MW of 30.4 kDa, containing 276 amino acids. The protein migrates as 40-50 kDa in SDS-PAGE under reducing condition due to glycosylation.
bioactivity :	Testing in progress.