Product - Abyntek Biopharma

Protein

Recombinant Bovine coronavirus Spike glycoprotein (S), partial

DESCRIPCIÓN

Supplier:	Biorbyt
Reference:	orb1096671
Name:	Recombinant Bovine coronavirus Spike glycoprotein (S), partial
Category:	Protein
Subcategory:	Proteins
Aditional Names:	S glycoprotein, E2, Peplomer protein
Unit:	1 mg
price :	Consultar
format :	Liquid or Lyophilized powder
note :	Bovine coronavirus (strain Quebec) (BCoV) (BCV)
Aa sequence :	TVQPIADVYRRIPNLPDCNIEAWLNDKSVPSPLNWERKTFSNCNFNMSSLMSFIQADSFTCNNIDAAKIYGMCFSSITIDKFAIPNGRKVDLQLGNLGYLQSFNYRIDTTATSCQLYYNLPAANVSVSRFNPSTWNRRFGFTEQFVFKPQPVGVFTHHDVVYAQHCFKAPKNFCPCKLDGSLCVGNGPGIDAGYKNSGIGTCPAGTNYLTCHNAAQCDCLCTPDPITSKSTGPYKCPQTKYLVGIGEHCSGLAIK
buffer :	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
purity :	Greater than 90% as determined by SDS-PAGE.
endotoxin :	Not test.
tag :	C-terminal 6xHis-tagged
Molecular weight :	36.8 kDa
Uniprot number :	P25193