Product - Abyntek Biopharma

Protein

Recombinant Severe acute respiratory syndrome coronavirus 3C-like proteinase, partial

DESCRIPCIÓN

Supplier:	Biorbyt
Reference:	orb1096654
Name:	Recombinant Severe acute respiratory syndrome coronavirus 3C-like proteinase, partial
Category:	Protein
Subcategory:	Proteins
Aditional Names:	Growth factor-like peptide, Leader protein, Non-structural protein 10, Non-structural protein 2, Non-structural protein 3, Non-structural protein 4, Non-structural protein 6, Non-structural protein 7, Non-structural protein 8, Non-structural protein 9, Papain-like proteinase, p65 homolog
Unit:	20 ug
price :	Consultar
format :	Liquid or Lyophilized powder
note :	Severe acute respiratory syndrome coronavirus (SARS-CoV)
Aa sequence :	GKFKKIVKGTHHWMLLTFLTSLLILVQSTQWSLFFFVYENAFLPFTLGIMAIAACAMLLVKHKHAFLCLFLLPSLATVAYFNMVYMPASWVMRIMTWLELADTSLSGYRLKDCVMYASALVLLILMTARTVYDDAARRVWTLMNVITLVYKVYYGNALDQAISMWALVISVTSNYSGVVTTIMFLARAIVFVCVEYYPLLFITGNTLQCIMLVYCFLGYCCCCYFGLFCLLNRYFRLTLGVYDYLVSTQEFRYMN
buffer :	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
purity :	Greater than 85% as determined by SDS-PAGE.
endotoxin :	Not test.
tag :	N-terminal 10xHis-tagged
Molecular weight :	35.8 kDa
Uniprot number :	C8YZ74