Product - Abyntek Biopharma

Protein

Recombinant Human Novel Coronavirus Spike glycoprotein(S)(K417N,E484K,N501Y),partial

DESCRIPCIÓN

Supplier:	Biorbyt
Reference:	orb1096686
Name:	Recombinant Human Novel Coronavirus Spike glycoprotein(S)(K417N,E484K,N501Y),partial
Category:	Protein
Subcategory:	Proteins
Aditional Names:	(S glycoprotein)(Peplomer protein)(Spike protein S1)(Spike protein S2)
Unit:	100 ug
price :	Consultar
format :	Lyophilized powder
note :	Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2)
Aa sequence :	RVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGNIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVKGFNCYFPLQSYGFQPTYGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNF
buffer :	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
purity :	Greater than 90% as determined by SDS-PAGE.
endotoxin :	Less than 1.0 EU/ug as determined by LAL method.
specificactivity :	N/A
tag :	C-terminal 10xHis-tagged
Molecular weight :	27.9 kDa
Uniprot number :	P0DTC2