Product - Abyntek Biopharma

Protein

Bat coronavirus HKU9 Nucleoprotein Protein

DESCRIPCIÓN

Supplier:	Biorbyt
Reference:	orb1477332
Name:	Bat coronavirus HKU9 Nucleoprotein Protein
Category:	Protein
Subcategory:	Proteins
Aditional Names:	(Nucleocapsid protein)(NC)(Protein N)
Unit:	100 ug
price :	Consultar
format :	Liquid or Lyophilized powder
note :	Bat coronavirus HKU9 (BtCoV) (BtCoV/HKU9)
Aa sequence :	MSGRNRSRSGTPSPKVTFKQESDGSDSESERRNGNRNGARPKNNNSRGSAPKPEKPKAAPPQNVSWFAPLVQTGKAELRFPRGEGVPVSQGVDSTYEHGYWLRTQRSFQKGGKQVLANPRWYFYYTGTGRFGDLRFGTKNPDIVWVGQEGANINRLGDMGTRNPSNDGAIPVQLAGGIPKGFYAEGRGSRGNSRSSSRNSSRASSRGNSRASSRGASPGRPAANPSTEPWMAYLVQKLERLESQVSGTKPATKNP
buffer :	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
purity :	Greater than 85% as determined by SDS-PAGE.
endotoxin :	Not test.
tag :	N-terminal 6xHis-tagged
Molecular weight :	54.2 kDa
Uniprot number :	A3EXH0